PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G131500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bHLH
Protein Properties Length: 225aa    MW: 25926.3 Da    PI: 6.7265
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G131500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH33.38.5e-113280555
                        HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                 HLH  5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                           +E++RR++++  +++L +llP +  ++++ ls  +   +A++YIksL+
  Prupe.3G131500.1.p 32 RRVIEKNRRNQMKVLYSKLNSLLPRQ--NSQEPLSLPDQIDEAINYIKSLE 80
                        5689*********************6..26666****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474594.32E-122596IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000833.47E-62584No hitNo description
PROSITE profilePS5088812.152779IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.3E-93098IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003535.9E-43385IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.1E-73380IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGSFVANLEE RDHQIQMDHN QGSQSSSTKV ERRVIEKNRR NQMKVLYSKL NSLLPRQNSQ  60
EPLSLPDQID EAINYIKSLE TKLQKSKEKR DSLKGKKKRS HTACTNFDSM RCSKPPQIEI  120
HEMGSTLEVV LISGLDNHQF MFTEIIRIVH EEQADVVHAS LSTLGDSIFH VIRAEVGKSM  180
IDFGAAKITE KLRRFVNGST SDEELQREYL WDFEIYPETL WDQF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18898KRDSLKGKKKR
296100KKRSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228998.11e-158PREDICTED: transcription factor bHLH36-like
TrEMBLM5VT391e-155M5VT39_PRUPE; Uncharacterized protein
STRINGGLYMA06G44660.24e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.13e-40bHLH family protein